PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000270267
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 293aa    MW: 32827.7 Da    PI: 9.338
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000270267genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.8e-131460147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g W +eEde+l+ +v++ Gg++W++ a++ g+ R++ +c+  w +y
    MDP0000270267 14 KGQWLEEEDERLKTYVNLKGGRRWDALAKESGLXRSGRSCRIQWMNY 60
                     799*******************************************9 PP

2Myb_DNA-binding25.14.1e-08139169234
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkg 34 
                       +WT++E++++++a++++  + Wk I +++g  
    MDP0000270267 139 XSWTEQEHDKFLEAFQLFDHD-WKNIEACIG-S 169
                      68*****************99.******999.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-12868IPR009057Homeodomain-like
PROSITE profilePS5129416.858965IPR017930Myb domain
SuperFamilySSF466894.79E-131262IPR009057Homeodomain-like
SMARTSM007173.7E-81363IPR001005SANT/Myb domain
PfamPF002498.9E-111460IPR001005SANT/Myb domain
CDDcd001671.98E-81761No hitNo description
PROSITE profilePS500904.844133170IPR017877Myb-like domain
SMARTSM007170.13137183IPR001005SANT/Myb domain
PfamPF002491.0E-5138170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-4138166IPR009057Homeodomain-like
SuperFamilySSF466894.79E-13139171IPR009057Homeodomain-like
CDDcd001670.002140170No hitNo description
PfamPF136641.1E-14210287IPR025423Domain of unknown function DUF4149
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTCLAAVEGE KLRKGQWLEE EDERLKTYVN LKGGRRWDAL AKESGLXRSG RSCRIQWMNY  60
VXLNIKHGFC LFNPMNTNMG LPGLNPMSPP XIGAASATAV TCTTAAYTSX SAPANTVSML  120
VDDQSKKIQK PYTITKSKXS WTEQEHDKFL EAFQLFDHDW KNIEACIGSK IVIQTKIXKE  180
NSERKKVAVA FLAIRVIFSP ETFGXKSDGG IIMFKNLSRN QFGNLQSKMF XVYFTMVGIC  240
LAVSAGSFGY LHPWSSSSVA DKYQLDFLLS AFAFNLTNLF VFTPMTIXVI ASY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.59333e-95bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.16e-23MYB_related family protein